Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4130143..4130663 Replicon chromosome
Accession NZ_CP124517
Organism Escherichia coli strain AVS0343

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJB09_RS20195 Protein ID WP_001160964.1
Coordinates 4130379..4130663 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJB09_RS20190 Protein ID WP_000125566.1
Coordinates 4130143..4130376 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB09_RS20165 (4125216) 4125216..4125503 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJB09_RS20170 (4125562) 4125562..4126893 + 1332 WP_001183209.1 MFS transporter -
QJB09_RS20175 (4127001) 4127001..4127531 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJB09_RS20180 (4127524) 4127524..4129386 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJB09_RS20185 (4129578) 4129578..4130057 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJB09_RS20190 (4130143) 4130143..4130376 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJB09_RS20195 (4130379) 4130379..4130663 + 285 WP_001160964.1 CcdB family protein Toxin
QJB09_RS20200 (4130690) 4130690..4131538 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJB09_RS20205 (4131545) 4131545..4131922 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJB09_RS20210 (4131925) 4131925..4132746 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJB09_RS20215 (4132743) 4132743..4133732 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJB09_RS20220 (4133732) 4133732..4135018 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T280800 WP_001160964.1 NZ_CP124517:4130379-4130663 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280800 WP_000125566.1 NZ_CP124517:4130143-4130376 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References