Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3938019..3938854 | Replicon | chromosome |
| Accession | NZ_CP124517 | ||
| Organism | Escherichia coli strain AVS0343 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJB09_RS19275 | Protein ID | WP_000854759.1 |
| Coordinates | 3938477..3938854 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJB09_RS19270 | Protein ID | WP_001295723.1 |
| Coordinates | 3938019..3938387 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB09_RS19245 (3935134) | 3935134..3935329 | + | 196 | Protein_3766 | DUF905 family protein | - |
| QJB09_RS19250 (3935447) | 3935447..3936265 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJB09_RS19255 (3936607) | 3936607..3937080 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJB09_RS19260 (3937096) | 3937096..3937572 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QJB09_RS19265 (3937635) | 3937635..3937856 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJB09_RS19270 (3938019) | 3938019..3938387 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB09_RS19275 (3938477) | 3938477..3938854 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJB09_RS19280 (3938851) | 3938851..3939339 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJB09_RS19285 (3939356) | 3939356..3939532 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJB09_RS19290 (3939638) | 3939638..3939787 | + | 150 | Protein_3775 | hypothetical protein | - |
| QJB09_RS19295 (3940154) | 3940154..3940459 | + | 306 | Protein_3776 | helix-turn-helix domain-containing protein | - |
| QJB09_RS19300 (3941121) | 3941121..3942743 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3924324..3951810 | 27486 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T280798 WP_000854759.1 NZ_CP124517:3938477-3938854 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT280798 WP_001295723.1 NZ_CP124517:3938019-3938387 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |