Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 3841206..3841801 | Replicon | chromosome |
| Accession | NZ_CP124517 | ||
| Organism | Escherichia coli strain AVS0343 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | QJB09_RS18780 | Protein ID | WP_000239579.1 |
| Coordinates | 3841451..3841801 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | QJB09_RS18775 | Protein ID | WP_001223208.1 |
| Coordinates | 3841206..3841457 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB09_RS18765 (3836871) | 3836871..3840650 | + | 3780 | WP_000060945.1 | autotransporter assembly complex protein TamB | - |
| QJB09_RS18770 (3840653) | 3840653..3840994 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| QJB09_RS18775 (3841206) | 3841206..3841457 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| QJB09_RS18780 (3841451) | 3841451..3841801 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| QJB09_RS18785 (3841881) | 3841881..3842411 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| QJB09_RS18790 (3842721) | 3842721..3843677 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| QJB09_RS18795 (3843817) | 3843817..3845319 | + | 1503 | WP_000205813.1 | sugar ABC transporter ATP-binding protein | - |
| QJB09_RS18800 (3845333) | 3845333..3846355 | + | 1023 | WP_001296689.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T280797 WP_000239579.1 NZ_CP124517:3841451-3841801 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |