Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2374969..2375803 Replicon chromosome
Accession NZ_CP124517
Organism Escherichia coli strain AVS0343

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJB09_RS11805 Protein ID WP_000854690.1
Coordinates 2375426..2375803 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJB09_RS11800 Protein ID WP_001305076.1
Coordinates 2374969..2375337 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB09_RS11760 (2370051) 2370051..2371178 + 1128 Protein_2314 hypothetical protein -
QJB09_RS11765 (2371254) 2371254..2371709 + 456 WP_000581502.1 IrmA family protein -
QJB09_RS11770 (2371788) 2371788..2372021 + 234 WP_000902034.1 DUF905 family protein -
QJB09_RS11775 (2372122) 2372122..2372940 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJB09_RS11780 (2372995) 2372995..2373480 + 486 WP_000849565.1 antirestriction protein -
QJB09_RS11785 (2373496) 2373496..2373972 + 477 WP_001186726.1 RadC family protein -
QJB09_RS11790 (2374035) 2374035..2374256 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJB09_RS11795 (2374275) 2374275..2374919 + 645 WP_000094916.1 hypothetical protein -
QJB09_RS11800 (2374969) 2374969..2375337 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJB09_RS11805 (2375426) 2375426..2375803 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJB09_RS11810 (2375800) 2375800..2376288 + 489 WP_000761699.1 DUF5983 family protein -
QJB09_RS11815 (2376305) 2376305..2376502 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJB09_RS11820 (2376587) 2376587..2377432 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJB09_RS11825 (2377501) 2377501..2377896 + 396 WP_000208384.1 DUF6088 family protein -
QJB09_RS11830 (2377889) 2377889..2378822 + 934 Protein_2328 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJB09_RS11835 (2379239) 2379239..2379409 + 171 Protein_2329 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT 2330691..2397012 66321
- flank IS/Tn - - 2379254..2379409 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T280791 WP_000854690.1 NZ_CP124517:2375426-2375803 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT280791 WP_001305076.1 NZ_CP124517:2374969-2375337 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References