Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1277230..1278061 Replicon chromosome
Accession NZ_CP124517
Organism Escherichia coli strain AVS0343

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJB09_RS06730 Protein ID WP_000854815.1
Coordinates 1277687..1278061 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJB09_RS06725 Protein ID WP_001280918.1
Coordinates 1277230..1277598 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB09_RS06680 (1272319) 1272319..1273065 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJB09_RS06685 (1273148) 1273148..1273498 + 351 Protein_1320 hypothetical protein -
QJB09_RS06690 (1273514) 1273514..1273924 + 411 WP_000846703.1 hypothetical protein -
QJB09_RS06695 (1274145) 1274145..1274963 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJB09_RS06700 (1274963) 1274963..1275208 + 246 WP_001164966.1 hypothetical protein -
QJB09_RS06705 (1275302) 1275302..1275775 + 474 WP_001542276.1 antirestriction protein -
QJB09_RS06710 (1275791) 1275791..1276267 + 477 WP_001186200.1 RadC family protein -
QJB09_RS06715 (1276330) 1276330..1276551 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJB09_RS06720 (1276570) 1276570..1277214 + 645 WP_000086752.1 hypothetical protein -
QJB09_RS06725 (1277230) 1277230..1277598 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJB09_RS06730 (1277687) 1277687..1278061 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJB09_RS06735 (1278058) 1278058..1278252 + 195 WP_000988600.1 DUF5983 family protein -
QJB09_RS06740 (1278298) 1278298..1278378 + 81 Protein_1331 hypothetical protein -
QJB09_RS06745 (1278667) 1278667..1278747 - 81 WP_023441679.1 hypothetical protein -
QJB09_RS06750 (1278726) 1278726..1279049 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJB09_RS06755 (1279150) 1279150..1279479 - 330 WP_000450409.1 DUF496 family protein -
QJB09_RS06760 (1279651) 1279651..1280709 - 1059 WP_001200889.1 FUSC family protein -
QJB09_RS06765 (1280907) 1280907..1281380 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJB09_RS06770 (1281499) 1281499..1282665 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T280788 WP_000854815.1 NZ_CP124517:1277687-1278061 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT280788 WP_001280918.1 NZ_CP124517:1277230-1277598 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References