Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4044391..4044941 Replicon chromosome
Accession NZ_CP124515
Organism Escherichia coli strain AVS0282

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP70_RS19745 Protein ID WP_001160966.1
Coordinates 4044391..4044705 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP70_RS19750 Protein ID WP_000125566.1
Coordinates 4044708..4044941 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP70_RS19720 (4040066) 4040066..4041352 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP70_RS19725 (4041352) 4041352..4042341 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP70_RS19730 (4042338) 4042338..4043159 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP70_RS19735 (4043162) 4043162..4043539 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP70_RS19740 (4043546) 4043546..4044394 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP70_RS19745 (4044391) 4044391..4044705 - 315 WP_001160966.1 CcdB family protein Toxin
QJP70_RS19750 (4044708) 4044708..4044941 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP70_RS19755 (4045027) 4045027..4045506 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP70_RS19760 (4045698) 4045698..4047560 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP70_RS19765 (4047553) 4047553..4048083 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP70_RS19770 (4048191) 4048191..4049522 - 1332 WP_001183207.1 MFS transporter -
QJP70_RS19775 (4049581) 4049581..4049868 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T280774 WP_001160966.1 NZ_CP124515:c4044705-4044391 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280774 WP_000125566.1 NZ_CP124515:c4044941-4044708 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References