Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2023265..2024096 Replicon chromosome
Accession NZ_CP124515
Organism Escherichia coli strain AVS0282

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP70_RS09660 Protein ID WP_000854814.1
Coordinates 2023265..2023639 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP70_RS09665 Protein ID WP_001546021.1
Coordinates 2023728..2024096 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP70_RS09625 (2019260) 2019260..2019589 + 330 WP_000450409.1 DUF496 family protein -
QJP70_RS09630 (2019690) 2019690..2020013 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP70_RS09635 (2019992) 2019992..2020072 + 81 WP_023441679.1 hypothetical protein -
QJP70_RS09640 (2020283) 2020283..2021824 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP70_RS09645 (2021839) 2021839..2022585 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP70_RS09650 (2022948) 2022948..2023028 - 81 Protein_1896 hypothetical protein -
QJP70_RS09655 (2023074) 2023074..2023268 - 195 WP_000988601.1 DUF5983 family protein -
QJP70_RS09660 (2023265) 2023265..2023639 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP70_RS09665 (2023728) 2023728..2024096 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP70_RS09670 (2024176) 2024176..2024397 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP70_RS09675 (2024460) 2024460..2024936 - 477 WP_001186773.1 RadC family protein -
QJP70_RS09680 (2024952) 2024952..2025425 - 474 WP_001385393.1 antirestriction protein -
QJP70_RS09685 (2025688) 2025688..2026509 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP70_RS09690 (2026730) 2026730..2027140 - 411 WP_000846704.1 hypothetical protein -
QJP70_RS09695 (2027156) 2027156..2027833 - 678 WP_001362823.1 hypothetical protein -
QJP70_RS09700 (2027969) 2027969..2029039 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280764 WP_000854814.1 NZ_CP124515:c2023639-2023265 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280764 WP_001546021.1 NZ_CP124515:c2024096-2023728 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References