Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4529797..4530632 | Replicon | chromosome |
| Accession | NZ_CP124513 | ||
| Organism | Escherichia coli strain AVS0366 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VR61 |
| Locus tag | QJP86_RS22090 | Protein ID | WP_000854747.1 |
| Coordinates | 4530255..4530632 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
| Locus tag | QJP86_RS22085 | Protein ID | WP_024186867.1 |
| Coordinates | 4529797..4530165 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP86_RS22050 (4525709) | 4525709..4526389 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QJP86_RS22055 (4526537) | 4526537..4527214 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP86_RS22060 (4527220) | 4527220..4527453 | + | 234 | WP_001278280.1 | DUF905 family protein | - |
| QJP86_RS22065 (4527543) | 4527543..4528361 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QJP86_RS22070 (4528452) | 4528452..4528937 | + | 486 | WP_001588934.1 | antirestriction protein | - |
| QJP86_RS22075 (4528952) | 4528952..4529428 | + | 477 | WP_001588933.1 | RadC family protein | - |
| QJP86_RS22080 (4529497) | 4529497..4529718 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJP86_RS22085 (4529797) | 4529797..4530165 | + | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP86_RS22090 (4530255) | 4530255..4530632 | + | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
| QJP86_RS22095 (4530629) | 4530629..4531117 | + | 489 | WP_000761667.1 | DUF5983 family protein | - |
| QJP86_RS22100 (4531129) | 4531129..4531326 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QJP86_RS22105 (4531411) | 4531411..4532265 | + | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
| QJP86_RS22110 (4532583) | 4532583..4532742 | + | 160 | Protein_4336 | integrase | - |
| QJP86_RS22115 (4533002) | 4533002..4534540 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4517113..4558036 | 40923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T280755 WP_000854747.1 NZ_CP124513:4530255-4530632 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT280755 WP_024186867.1 NZ_CP124513:4529797-4530165 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A0PK89 |