Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4218007..4218841 | Replicon | chromosome |
| Accession | NZ_CP124513 | ||
| Organism | Escherichia coli strain AVS0366 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP86_RS20580 | Protein ID | WP_000854770.1 |
| Coordinates | 4218007..4218384 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP86_RS20585 | Protein ID | WP_001280950.1 |
| Coordinates | 4218473..4218841 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP86_RS20555 (4214118) | 4214118..4215740 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJP86_RS20560 (4216402) | 4216402..4216707 | - | 306 | Protein_4031 | helix-turn-helix domain-containing protein | - |
| QJP86_RS20565 (4217074) | 4217074..4217223 | - | 150 | Protein_4032 | hypothetical protein | - |
| QJP86_RS20570 (4217329) | 4217329..4217505 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP86_RS20575 (4217522) | 4217522..4218010 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP86_RS20580 (4218007) | 4218007..4218384 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP86_RS20585 (4218473) | 4218473..4218841 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP86_RS20590 (4219004) | 4219004..4219225 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP86_RS20595 (4219288) | 4219288..4219764 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJP86_RS20600 (4219780) | 4219780..4220244 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJP86_RS20605 (4220586) | 4220586..4221404 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJP86_RS20610 (4221522) | 4221522..4221717 | - | 196 | Protein_4041 | DUF905 family protein | - |
| QJP86_RS20615 (4221788) | 4221788..4223689 | - | 1902 | Protein_4042 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4206361..4246570 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280754 WP_000854770.1 NZ_CP124513:c4218384-4218007 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT280754 WP_001280950.1 NZ_CP124513:c4218841-4218473 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |