Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4037440..4037990 Replicon chromosome
Accession NZ_CP124513
Organism Escherichia coli strain AVS0366

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP86_RS19670 Protein ID WP_001160966.1
Coordinates 4037440..4037754 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP86_RS19675 Protein ID WP_000125566.1
Coordinates 4037757..4037990 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP86_RS19645 (4033115) 4033115..4034401 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP86_RS19650 (4034401) 4034401..4035390 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP86_RS19655 (4035387) 4035387..4036208 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP86_RS19660 (4036211) 4036211..4036588 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP86_RS19665 (4036595) 4036595..4037443 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP86_RS19670 (4037440) 4037440..4037754 - 315 WP_001160966.1 CcdB family protein Toxin
QJP86_RS19675 (4037757) 4037757..4037990 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP86_RS19680 (4038076) 4038076..4038555 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP86_RS19685 (4038747) 4038747..4040609 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP86_RS19690 (4040602) 4040602..4041132 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP86_RS19695 (4041240) 4041240..4042571 - 1332 WP_001183207.1 MFS transporter -
QJP86_RS19700 (4042630) 4042630..4042917 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T280752 WP_001160966.1 NZ_CP124513:c4037754-4037440 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280752 WP_000125566.1 NZ_CP124513:c4037990-4037757 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References