Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2013613..2014444 Replicon chromosome
Accession NZ_CP124513
Organism Escherichia coli strain AVS0366

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP86_RS09585 Protein ID WP_000854814.1
Coordinates 2013613..2013987 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP86_RS09590 Protein ID WP_001546021.1
Coordinates 2014076..2014444 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP86_RS09550 (2009608) 2009608..2009937 + 330 WP_000450409.1 DUF496 family protein -
QJP86_RS09555 (2010038) 2010038..2010361 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP86_RS09560 (2010340) 2010340..2010420 + 81 WP_023441679.1 hypothetical protein -
QJP86_RS09565 (2010631) 2010631..2012172 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP86_RS09570 (2012187) 2012187..2012933 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP86_RS09575 (2013296) 2013296..2013376 - 81 Protein_1879 hypothetical protein -
QJP86_RS09580 (2013422) 2013422..2013616 - 195 WP_000988601.1 DUF5983 family protein -
QJP86_RS09585 (2013613) 2013613..2013987 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP86_RS09590 (2014076) 2014076..2014444 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP86_RS09595 (2014524) 2014524..2014745 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP86_RS09600 (2014808) 2014808..2015284 - 477 WP_001186773.1 RadC family protein -
QJP86_RS09605 (2015300) 2015300..2015773 - 474 WP_001385393.1 antirestriction protein -
QJP86_RS09610 (2016036) 2016036..2016857 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP86_RS09615 (2017078) 2017078..2017488 - 411 WP_000846704.1 hypothetical protein -
QJP86_RS09620 (2017504) 2017504..2018181 - 678 WP_001362823.1 hypothetical protein -
QJP86_RS09625 (2018317) 2018317..2019387 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280742 WP_000854814.1 NZ_CP124513:c2013987-2013613 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280742 WP_001546021.1 NZ_CP124513:c2014444-2014076 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References