Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2013613..2014444 | Replicon | chromosome |
| Accession | NZ_CP124513 | ||
| Organism | Escherichia coli strain AVS0366 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QJP86_RS09585 | Protein ID | WP_000854814.1 |
| Coordinates | 2013613..2013987 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A641DSP2 |
| Locus tag | QJP86_RS09590 | Protein ID | WP_001546021.1 |
| Coordinates | 2014076..2014444 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP86_RS09550 (2009608) | 2009608..2009937 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJP86_RS09555 (2010038) | 2010038..2010361 | - | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
| QJP86_RS09560 (2010340) | 2010340..2010420 | + | 81 | WP_023441679.1 | hypothetical protein | - |
| QJP86_RS09565 (2010631) | 2010631..2012172 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP86_RS09570 (2012187) | 2012187..2012933 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP86_RS09575 (2013296) | 2013296..2013376 | - | 81 | Protein_1879 | hypothetical protein | - |
| QJP86_RS09580 (2013422) | 2013422..2013616 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| QJP86_RS09585 (2013613) | 2013613..2013987 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJP86_RS09590 (2014076) | 2014076..2014444 | - | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP86_RS09595 (2014524) | 2014524..2014745 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QJP86_RS09600 (2014808) | 2014808..2015284 | - | 477 | WP_001186773.1 | RadC family protein | - |
| QJP86_RS09605 (2015300) | 2015300..2015773 | - | 474 | WP_001385393.1 | antirestriction protein | - |
| QJP86_RS09610 (2016036) | 2016036..2016857 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| QJP86_RS09615 (2017078) | 2017078..2017488 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| QJP86_RS09620 (2017504) | 2017504..2018181 | - | 678 | WP_001362823.1 | hypothetical protein | - |
| QJP86_RS09625 (2018317) | 2018317..2019387 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T280742 WP_000854814.1 NZ_CP124513:c2013987-2013613 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT280742 WP_001546021.1 NZ_CP124513:c2014444-2014076 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A641DSP2 |