Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4978375..4979206 | Replicon | chromosome |
| Accession | NZ_CP124511 | ||
| Organism | Escherichia coli strain AVS0501 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QJP59_RS24185 | Protein ID | WP_000854814.1 |
| Coordinates | 4978375..4978749 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A641DSP2 |
| Locus tag | QJP59_RS24190 | Protein ID | WP_001546021.1 |
| Coordinates | 4978838..4979206 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP59_RS24150 (4974370) | 4974370..4974699 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJP59_RS24155 (4974800) | 4974800..4975123 | - | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
| QJP59_RS24160 (4975102) | 4975102..4975182 | + | 81 | WP_023441679.1 | hypothetical protein | - |
| QJP59_RS24165 (4975393) | 4975393..4976934 | + | 1542 | Protein_4733 | IS21-like element ISEc12 family transposase | - |
| QJP59_RS24170 (4976949) | 4976949..4977695 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP59_RS24175 (4978058) | 4978058..4978138 | - | 81 | Protein_4735 | hypothetical protein | - |
| QJP59_RS24180 (4978184) | 4978184..4978378 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| QJP59_RS24185 (4978375) | 4978375..4978749 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJP59_RS24190 (4978838) | 4978838..4979206 | - | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP59_RS24195 (4979286) | 4979286..4979507 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QJP59_RS24200 (4979570) | 4979570..4980046 | - | 477 | WP_001186773.1 | RadC family protein | - |
| QJP59_RS24205 (4980062) | 4980062..4980535 | - | 474 | WP_001385393.1 | antirestriction protein | - |
| QJP59_RS24210 (4980798) | 4980798..4981619 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| QJP59_RS24215 (4981840) | 4981840..4982250 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| QJP59_RS24220 (4982266) | 4982266..4982943 | - | 678 | WP_001362823.1 | hypothetical protein | - |
| QJP59_RS24225 (4983079) | 4983079..4984149 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T280734 WP_000854814.1 NZ_CP124511:c4978749-4978375 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT280734 WP_001546021.1 NZ_CP124511:c4979206-4978838 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A641DSP2 |