Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4978375..4979206 Replicon chromosome
Accession NZ_CP124511
Organism Escherichia coli strain AVS0501

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP59_RS24185 Protein ID WP_000854814.1
Coordinates 4978375..4978749 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP59_RS24190 Protein ID WP_001546021.1
Coordinates 4978838..4979206 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP59_RS24150 (4974370) 4974370..4974699 + 330 WP_000450409.1 DUF496 family protein -
QJP59_RS24155 (4974800) 4974800..4975123 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP59_RS24160 (4975102) 4975102..4975182 + 81 WP_023441679.1 hypothetical protein -
QJP59_RS24165 (4975393) 4975393..4976934 + 1542 Protein_4733 IS21-like element ISEc12 family transposase -
QJP59_RS24170 (4976949) 4976949..4977695 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP59_RS24175 (4978058) 4978058..4978138 - 81 Protein_4735 hypothetical protein -
QJP59_RS24180 (4978184) 4978184..4978378 - 195 WP_000988601.1 DUF5983 family protein -
QJP59_RS24185 (4978375) 4978375..4978749 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP59_RS24190 (4978838) 4978838..4979206 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP59_RS24195 (4979286) 4979286..4979507 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP59_RS24200 (4979570) 4979570..4980046 - 477 WP_001186773.1 RadC family protein -
QJP59_RS24205 (4980062) 4980062..4980535 - 474 WP_001385393.1 antirestriction protein -
QJP59_RS24210 (4980798) 4980798..4981619 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP59_RS24215 (4981840) 4981840..4982250 - 411 WP_000846704.1 hypothetical protein -
QJP59_RS24220 (4982266) 4982266..4982943 - 678 WP_001362823.1 hypothetical protein -
QJP59_RS24225 (4983079) 4983079..4984149 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280734 WP_000854814.1 NZ_CP124511:c4978749-4978375 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280734 WP_001546021.1 NZ_CP124511:c4979206-4978838 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References