Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3791920..3792754 | Replicon | chromosome |
| Accession | NZ_CP124511 | ||
| Organism | Escherichia coli strain AVS0501 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QJP59_RS18640 | Protein ID | WP_001546109.1 |
| Coordinates | 3791920..3792297 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QJP59_RS18645 | Protein ID | WP_282517600.1 |
| Coordinates | 3792374..3792754 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP59_RS18610 (3788314) | 3788314..3788484 | - | 171 | Protein_3641 | IS110 family transposase | - |
| QJP59_RS18615 (3788901) | 3788901..3789835 | - | 935 | Protein_3642 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP59_RS18620 (3789828) | 3789828..3790223 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| QJP59_RS18625 (3790292) | 3790292..3791137 | - | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| QJP59_RS18630 (3791222) | 3791222..3791419 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| QJP59_RS18635 (3791436) | 3791436..3791923 | - | 488 | Protein_3646 | DUF5983 family protein | - |
| QJP59_RS18640 (3791920) | 3791920..3792297 | - | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| QJP59_RS18645 (3792374) | 3792374..3792754 | - | 381 | WP_282517600.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP59_RS18650 (3792804) | 3792804..3793448 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| QJP59_RS18655 (3793467) | 3793467..3793688 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP59_RS18660 (3793757) | 3793757..3794233 | - | 477 | WP_001424026.1 | RadC family protein | - |
| QJP59_RS18665 (3794249) | 3794249..3794734 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| QJP59_RS18670 (3794789) | 3794789..3795607 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP59_RS18675 (3795707) | 3795707..3795940 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJP59_RS18680 (3796019) | 3796019..3796474 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T280731 WP_001546109.1 NZ_CP124511:c3792297-3791920 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14069.84 Da Isoelectric Point: 4.8331
>AT280731 WP_282517600.1 NZ_CP124511:c3792754-3792374 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLESCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLESCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|