Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2414577..2415412 | Replicon | chromosome |
| Accession | NZ_CP124511 | ||
| Organism | Escherichia coli strain AVS0501 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VR61 |
| Locus tag | QJP59_RS12125 | Protein ID | WP_000854747.1 |
| Coordinates | 2415035..2415412 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
| Locus tag | QJP59_RS12120 | Protein ID | WP_024186867.1 |
| Coordinates | 2414577..2414945 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP59_RS12085 (2410489) | 2410489..2411169 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QJP59_RS12090 (2411317) | 2411317..2411994 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP59_RS12095 (2412000) | 2412000..2412233 | + | 234 | WP_001278280.1 | DUF905 family protein | - |
| QJP59_RS12100 (2412323) | 2412323..2413141 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QJP59_RS12105 (2413232) | 2413232..2413717 | + | 486 | WP_001588934.1 | antirestriction protein | - |
| QJP59_RS12110 (2413732) | 2413732..2414208 | + | 477 | WP_001588933.1 | RadC family protein | - |
| QJP59_RS12115 (2414277) | 2414277..2414498 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJP59_RS12120 (2414577) | 2414577..2414945 | + | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP59_RS12125 (2415035) | 2415035..2415412 | + | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
| QJP59_RS12130 (2415409) | 2415409..2415897 | + | 489 | WP_000761667.1 | DUF5983 family protein | - |
| QJP59_RS12135 (2415909) | 2415909..2416106 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QJP59_RS12140 (2416191) | 2416191..2417045 | + | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
| QJP59_RS12145 (2417363) | 2417363..2417522 | + | 160 | Protein_2388 | integrase | - |
| QJP59_RS12150 (2417782) | 2417782..2419320 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2401893..2442816 | 40923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T280725 WP_000854747.1 NZ_CP124511:2415035-2415412 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT280725 WP_024186867.1 NZ_CP124511:2414577-2414945 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A0PK89 |