Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1545752..1546370 | Replicon | chromosome |
| Accession | NZ_CP124511 | ||
| Organism | Escherichia coli strain AVS0501 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJP59_RS07970 | Protein ID | WP_001291435.1 |
| Coordinates | 1546152..1546370 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJP59_RS07965 | Protein ID | WP_000344800.1 |
| Coordinates | 1545752..1546126 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP59_RS07955 (1540841) | 1540841..1542034 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QJP59_RS07960 (1542057) | 1542057..1545206 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJP59_RS07965 (1545752) | 1545752..1546126 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJP59_RS07970 (1546152) | 1546152..1546370 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJP59_RS07975 (1546543) | 1546543..1547094 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJP59_RS07980 (1547210) | 1547210..1547680 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QJP59_RS07985 (1547844) | 1547844..1549394 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJP59_RS07990 (1549436) | 1549436..1549789 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
| QJP59_RS08000 (1550168) | 1550168..1550479 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QJP59_RS08005 (1550510) | 1550510..1551082 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280721 WP_001291435.1 NZ_CP124511:1546152-1546370 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280721 WP_000344800.1 NZ_CP124511:1545752-1546126 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |