Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 62742..63343 | Replicon | plasmid pAVS0068-B |
| Accession | NZ_CP124510 | ||
| Organism | Escherichia coli strain AVS0068 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | QJB02_RS25400 | Protein ID | WP_001216045.1 |
| Coordinates | 62742..63122 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | QJB02_RS25405 | Protein ID | WP_001190712.1 |
| Coordinates | 63122..63343 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB02_RS25375 (QJB02_25375) | 58182..59624 | - | 1443 | WP_224114847.1 | terminase | - |
| QJB02_RS25380 (QJB02_25380) | 59666..60859 | - | 1194 | WP_000219605.1 | terminase | - |
| QJB02_RS25385 (QJB02_25385) | 60946..61398 | - | 453 | WP_001369802.1 | hypothetical protein | - |
| QJB02_RS25390 (QJB02_25390) | 61487..62530 | - | 1044 | WP_000648824.1 | DUF968 domain-containing protein | - |
| QJB02_RS25395 (QJB02_25395) | 62558..62737 | - | 180 | WP_001339207.1 | hypothetical protein | - |
| QJB02_RS25400 (QJB02_25400) | 62742..63122 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QJB02_RS25405 (QJB02_25405) | 63122..63343 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QJB02_RS25410 (QJB02_25410) | 63416..63805 | - | 390 | WP_196234597.1 | S24 family peptidase | - |
| QJB02_RS25415 (QJB02_25415) | 63980..64552 | + | 573 | WP_001133670.1 | hypothetical protein | - |
| QJB02_RS25420 (QJB02_25420) | 64559..64810 | - | 252 | WP_069723427.1 | DNA polymerase III subunit theta | - |
| QJB02_RS25425 (QJB02_25425) | 65260..65397 | + | 138 | WP_000123562.1 | hypothetical protein | - |
| QJB02_RS25430 (QJB02_25430) | 65472..65834 | - | 363 | WP_001261544.1 | hypothetical protein | - |
| QJB02_RS25435 (QJB02_25435) | 65831..66763 | - | 933 | WP_000057449.1 | hypothetical protein | - |
| QJB02_RS25440 (QJB02_25440) | 66745..67119 | - | 375 | WP_000988658.1 | hypothetical protein | - |
| QJB02_RS25445 (QJB02_25445) | 67126..67419 | - | 294 | WP_001677496.1 | hypothetical protein | - |
| QJB02_RS25450 (QJB02_25450) | 67598..67831 | - | 234 | WP_000516537.1 | hypothetical protein | - |
| QJB02_RS25455 (QJB02_25455) | 67914..68210 | - | 297 | WP_224690240.1 | DUF551 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..94785 | 94785 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T280713 WP_001216045.1 NZ_CP124510:c63122-62742 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |