Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 62742..63343 Replicon plasmid pAVS0068-B
Accession NZ_CP124510
Organism Escherichia coli strain AVS0068

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag QJB02_RS25400 Protein ID WP_001216045.1
Coordinates 62742..63122 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJB02_RS25405 Protein ID WP_001190712.1
Coordinates 63122..63343 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB02_RS25375 (QJB02_25375) 58182..59624 - 1443 WP_224114847.1 terminase -
QJB02_RS25380 (QJB02_25380) 59666..60859 - 1194 WP_000219605.1 terminase -
QJB02_RS25385 (QJB02_25385) 60946..61398 - 453 WP_001369802.1 hypothetical protein -
QJB02_RS25390 (QJB02_25390) 61487..62530 - 1044 WP_000648824.1 DUF968 domain-containing protein -
QJB02_RS25395 (QJB02_25395) 62558..62737 - 180 WP_001339207.1 hypothetical protein -
QJB02_RS25400 (QJB02_25400) 62742..63122 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJB02_RS25405 (QJB02_25405) 63122..63343 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJB02_RS25410 (QJB02_25410) 63416..63805 - 390 WP_196234597.1 S24 family peptidase -
QJB02_RS25415 (QJB02_25415) 63980..64552 + 573 WP_001133670.1 hypothetical protein -
QJB02_RS25420 (QJB02_25420) 64559..64810 - 252 WP_069723427.1 DNA polymerase III subunit theta -
QJB02_RS25425 (QJB02_25425) 65260..65397 + 138 WP_000123562.1 hypothetical protein -
QJB02_RS25430 (QJB02_25430) 65472..65834 - 363 WP_001261544.1 hypothetical protein -
QJB02_RS25435 (QJB02_25435) 65831..66763 - 933 WP_000057449.1 hypothetical protein -
QJB02_RS25440 (QJB02_25440) 66745..67119 - 375 WP_000988658.1 hypothetical protein -
QJB02_RS25445 (QJB02_25445) 67126..67419 - 294 WP_001677496.1 hypothetical protein -
QJB02_RS25450 (QJB02_25450) 67598..67831 - 234 WP_000516537.1 hypothetical protein -
QJB02_RS25455 (QJB02_25455) 67914..68210 - 297 WP_224690240.1 DUF551 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..94785 94785


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T280713 WP_001216045.1 NZ_CP124510:c63122-62742 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280713 WP_001190712.1 NZ_CP124510:c63343-63122 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References