Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4452286..4453121 | Replicon | chromosome |
| Accession | NZ_CP124508 | ||
| Organism | Escherichia coli strain AVS0068 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VR61 |
| Locus tag | QJB02_RS21695 | Protein ID | WP_000854747.1 |
| Coordinates | 4452744..4453121 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
| Locus tag | QJB02_RS21690 | Protein ID | WP_024186867.1 |
| Coordinates | 4452286..4452654 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB02_RS21655 (4448198) | 4448198..4448878 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QJB02_RS21660 (4449026) | 4449026..4449703 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QJB02_RS21665 (4449709) | 4449709..4449942 | + | 234 | WP_001278280.1 | DUF905 family protein | - |
| QJB02_RS21670 (4450032) | 4450032..4450850 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QJB02_RS21675 (4450941) | 4450941..4451426 | + | 486 | WP_001588934.1 | antirestriction protein | - |
| QJB02_RS21680 (4451441) | 4451441..4451917 | + | 477 | WP_001588933.1 | RadC family protein | - |
| QJB02_RS21685 (4451986) | 4451986..4452207 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJB02_RS21690 (4452286) | 4452286..4452654 | + | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJB02_RS21695 (4452744) | 4452744..4453121 | + | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
| QJB02_RS21700 (4453118) | 4453118..4453606 | + | 489 | WP_000761667.1 | DUF5983 family protein | - |
| QJB02_RS21705 (4453618) | 4453618..4453815 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QJB02_RS21710 (4453900) | 4453900..4454754 | + | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
| QJB02_RS21715 (4455072) | 4455072..4455231 | + | 160 | Protein_4257 | integrase | - |
| QJB02_RS21720 (4455491) | 4455491..4457029 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4439602..4480525 | 40923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T280711 WP_000854747.1 NZ_CP124508:4452744-4453121 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT280711 WP_024186867.1 NZ_CP124508:4452286-4452654 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A0PK89 |