Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4139710..4140544 | Replicon | chromosome |
| Accession | NZ_CP124508 | ||
| Organism | Escherichia coli strain AVS0068 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJB02_RS20180 | Protein ID | WP_000854770.1 |
| Coordinates | 4139710..4140087 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJB02_RS20185 | Protein ID | WP_001280950.1 |
| Coordinates | 4140176..4140544 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB02_RS20155 (4135821) | 4135821..4137443 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJB02_RS20160 (4138105) | 4138105..4138410 | - | 306 | Protein_3951 | helix-turn-helix domain-containing protein | - |
| QJB02_RS20165 (4138777) | 4138777..4138926 | - | 150 | Protein_3952 | hypothetical protein | - |
| QJB02_RS20170 (4139032) | 4139032..4139208 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJB02_RS20175 (4139225) | 4139225..4139713 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJB02_RS20180 (4139710) | 4139710..4140087 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJB02_RS20185 (4140176) | 4140176..4140544 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB02_RS20190 (4140707) | 4140707..4140928 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJB02_RS20195 (4140991) | 4140991..4141467 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJB02_RS20200 (4141483) | 4141483..4141947 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJB02_RS20205 (4142289) | 4142289..4143107 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJB02_RS20210 (4143225) | 4143225..4143420 | - | 196 | Protein_3961 | DUF905 family protein | - |
| QJB02_RS20215 (4143491) | 4143491..4145392 | - | 1902 | Protein_3962 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4128064..4168273 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280710 WP_000854770.1 NZ_CP124508:c4140087-4139710 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT280710 WP_001280950.1 NZ_CP124508:c4140544-4140176 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |