Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3959143..3959693 Replicon chromosome
Accession NZ_CP124508
Organism Escherichia coli strain AVS0068

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJB02_RS19270 Protein ID WP_001160966.1
Coordinates 3959143..3959457 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJB02_RS19275 Protein ID WP_000125566.1
Coordinates 3959460..3959693 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB02_RS19245 (3954818) 3954818..3956104 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJB02_RS19250 (3956104) 3956104..3957093 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJB02_RS19255 (3957090) 3957090..3957911 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJB02_RS19260 (3957914) 3957914..3958291 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJB02_RS19265 (3958298) 3958298..3959146 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJB02_RS19270 (3959143) 3959143..3959457 - 315 WP_001160966.1 CcdB family protein Toxin
QJB02_RS19275 (3959460) 3959460..3959693 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJB02_RS19280 (3959779) 3959779..3960258 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJB02_RS19285 (3960450) 3960450..3962312 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJB02_RS19290 (3962305) 3962305..3962835 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJB02_RS19295 (3962943) 3962943..3964274 - 1332 WP_001183207.1 MFS transporter -
QJB02_RS19300 (3964333) 3964333..3964620 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T280708 WP_001160966.1 NZ_CP124508:c3959457-3959143 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280708 WP_000125566.1 NZ_CP124508:c3959693-3959460 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References