Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3546321..3546939 | Replicon | chromosome |
| Accession | NZ_CP124508 | ||
| Organism | Escherichia coli strain AVS0068 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJB02_RS17335 | Protein ID | WP_001291435.1 |
| Coordinates | 3546721..3546939 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJB02_RS17330 | Protein ID | WP_000344800.1 |
| Coordinates | 3546321..3546695 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB02_RS17320 (3541410) | 3541410..3542603 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QJB02_RS17325 (3542626) | 3542626..3545775 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJB02_RS17330 (3546321) | 3546321..3546695 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJB02_RS17335 (3546721) | 3546721..3546939 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJB02_RS17340 (3547112) | 3547112..3547663 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJB02_RS17345 (3547779) | 3547779..3548249 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QJB02_RS17350 (3548413) | 3548413..3549963 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJB02_RS17355 (3550005) | 3550005..3550358 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
| QJB02_RS17365 (3550737) | 3550737..3551048 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QJB02_RS17370 (3551079) | 3551079..3551651 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280706 WP_001291435.1 NZ_CP124508:3546721-3546939 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280706 WP_000344800.1 NZ_CP124508:3546321-3546695 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |