Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1936610..1937441 Replicon chromosome
Accession NZ_CP124508
Organism Escherichia coli strain AVS0068

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJB02_RS09200 Protein ID WP_000854814.1
Coordinates 1936610..1936984 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJB02_RS09205 Protein ID WP_001546021.1
Coordinates 1937073..1937441 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB02_RS09165 (1932605) 1932605..1932934 + 330 WP_000450409.1 DUF496 family protein -
QJB02_RS09170 (1933035) 1933035..1933358 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJB02_RS09175 (1933337) 1933337..1933417 + 81 WP_023441679.1 hypothetical protein -
QJB02_RS09180 (1933628) 1933628..1935169 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJB02_RS09185 (1935184) 1935184..1935930 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJB02_RS09190 (1936293) 1936293..1936373 - 81 Protein_1801 hypothetical protein -
QJB02_RS09195 (1936419) 1936419..1936613 - 195 WP_000988601.1 DUF5983 family protein -
QJB02_RS09200 (1936610) 1936610..1936984 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJB02_RS09205 (1937073) 1937073..1937441 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJB02_RS09210 (1937521) 1937521..1937742 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJB02_RS09215 (1937805) 1937805..1938281 - 477 WP_001186773.1 RadC family protein -
QJB02_RS09220 (1938297) 1938297..1938770 - 474 WP_001385393.1 antirestriction protein -
QJB02_RS09225 (1939033) 1939033..1939854 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJB02_RS09230 (1940075) 1940075..1940485 - 411 WP_000846704.1 hypothetical protein -
QJB02_RS09235 (1940501) 1940501..1941178 - 678 WP_001362823.1 hypothetical protein -
QJB02_RS09240 (1941314) 1941314..1942384 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280698 WP_000854814.1 NZ_CP124508:c1936984-1936610 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280698 WP_001546021.1 NZ_CP124508:c1937441-1937073 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References