Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4486891..4487726 | Replicon | chromosome |
| Accession | NZ_CP124506 | ||
| Organism | Escherichia coli strain AVS0750 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VR61 |
| Locus tag | QJP88_RS21995 | Protein ID | WP_000854747.1 |
| Coordinates | 4487349..4487726 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
| Locus tag | QJP88_RS21990 | Protein ID | WP_024186867.1 |
| Coordinates | 4486891..4487259 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP88_RS21955 (4482803) | 4482803..4483483 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QJP88_RS21960 (4483631) | 4483631..4484308 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP88_RS21965 (4484314) | 4484314..4484547 | + | 234 | WP_001278280.1 | DUF905 family protein | - |
| QJP88_RS21970 (4484637) | 4484637..4485455 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QJP88_RS21975 (4485546) | 4485546..4486031 | + | 486 | WP_001588934.1 | antirestriction protein | - |
| QJP88_RS21980 (4486046) | 4486046..4486522 | + | 477 | WP_001588933.1 | RadC family protein | - |
| QJP88_RS21985 (4486591) | 4486591..4486812 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJP88_RS21990 (4486891) | 4486891..4487259 | + | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP88_RS21995 (4487349) | 4487349..4487726 | + | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
| QJP88_RS22000 (4487723) | 4487723..4488211 | + | 489 | WP_000761667.1 | DUF5983 family protein | - |
| QJP88_RS22005 (4488223) | 4488223..4488420 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QJP88_RS22010 (4488505) | 4488505..4489359 | + | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
| QJP88_RS22015 (4489677) | 4489677..4489836 | + | 160 | Protein_4323 | integrase | - |
| QJP88_RS22020 (4490096) | 4490096..4491634 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4474207..4515130 | 40923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T280689 WP_000854747.1 NZ_CP124506:4487349-4487726 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT280689 WP_024186867.1 NZ_CP124506:4486891-4487259 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A0PK89 |