Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4181034..4181868 | Replicon | chromosome |
| Accession | NZ_CP124506 | ||
| Organism | Escherichia coli strain AVS0750 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP88_RS20505 | Protein ID | WP_000854770.1 |
| Coordinates | 4181034..4181411 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP88_RS20510 | Protein ID | WP_001280950.1 |
| Coordinates | 4181500..4181868 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP88_RS20480 (4177145) | 4177145..4178767 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJP88_RS20485 (4179429) | 4179429..4179734 | - | 306 | Protein_4021 | helix-turn-helix domain-containing protein | - |
| QJP88_RS20490 (4180101) | 4180101..4180250 | - | 150 | Protein_4022 | hypothetical protein | - |
| QJP88_RS20495 (4180356) | 4180356..4180532 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP88_RS20500 (4180549) | 4180549..4181037 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP88_RS20505 (4181034) | 4181034..4181411 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP88_RS20510 (4181500) | 4181500..4181868 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP88_RS20515 (4182031) | 4182031..4182252 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP88_RS20520 (4182315) | 4182315..4182791 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJP88_RS20525 (4182807) | 4182807..4183271 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJP88_RS20530 (4183613) | 4183613..4184431 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJP88_RS20535 (4184549) | 4184549..4184744 | - | 196 | Protein_4031 | DUF905 family protein | - |
| QJP88_RS20540 (4184815) | 4184815..4186716 | - | 1902 | Protein_4032 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4169388..4209597 | 40209 | |
| - | inside | Genomic island | - | - | 4172814..4209597 | 36783 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280688 WP_000854770.1 NZ_CP124506:c4181411-4181034 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT280688 WP_001280950.1 NZ_CP124506:c4181868-4181500 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |