Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3587881..3588499 | Replicon | chromosome |
| Accession | NZ_CP124506 | ||
| Organism | Escherichia coli strain AVS0750 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJP88_RS17670 | Protein ID | WP_001291435.1 |
| Coordinates | 3588281..3588499 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJP88_RS17665 | Protein ID | WP_000344800.1 |
| Coordinates | 3587881..3588255 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP88_RS17655 (3582970) | 3582970..3584163 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QJP88_RS17660 (3584186) | 3584186..3587335 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJP88_RS17665 (3587881) | 3587881..3588255 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJP88_RS17670 (3588281) | 3588281..3588499 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJP88_RS17675 (3588672) | 3588672..3589223 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJP88_RS17680 (3589339) | 3589339..3589809 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QJP88_RS17685 (3589973) | 3589973..3591523 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJP88_RS17690 (3591565) | 3591565..3591918 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
| QJP88_RS17700 (3592297) | 3592297..3592608 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QJP88_RS17705 (3592639) | 3592639..3593211 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280684 WP_001291435.1 NZ_CP124506:3588281-3588499 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280684 WP_000344800.1 NZ_CP124506:3587881-3588255 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |