Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4252601..4253435 | Replicon | chromosome |
| Accession | NZ_CP124502 | ||
| Organism | Escherichia coli strain AVS0970 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QJP73_RS20570 | Protein ID | WP_001546109.1 |
| Coordinates | 4253058..4253435 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | QJP73_RS20565 | Protein ID | WP_001546108.1 |
| Coordinates | 4252601..4252981 (+) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP73_RS20530 (4248881) | 4248881..4249336 | + | 456 | WP_001545736.1 | IrmA family protein | - |
| QJP73_RS20535 (4249415) | 4249415..4249648 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJP73_RS20540 (4249748) | 4249748..4250566 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP73_RS20545 (4250621) | 4250621..4251106 | + | 486 | WP_000849588.1 | antirestriction protein | - |
| QJP73_RS20550 (4251122) | 4251122..4251598 | + | 477 | WP_001424026.1 | RadC family protein | - |
| QJP73_RS20555 (4251667) | 4251667..4251888 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP73_RS20560 (4251907) | 4251907..4252551 | + | 645 | WP_000086755.1 | hypothetical protein | - |
| QJP73_RS20565 (4252601) | 4252601..4252981 | + | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP73_RS20570 (4253058) | 4253058..4253435 | + | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| QJP73_RS20575 (4253432) | 4253432..4253919 | + | 488 | Protein_4019 | DUF5983 family protein | - |
| QJP73_RS20580 (4253936) | 4253936..4254133 | + | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| QJP73_RS20585 (4254218) | 4254218..4255063 | + | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| QJP73_RS20590 (4255132) | 4255132..4255527 | + | 396 | WP_000208383.1 | DUF6088 family protein | - |
| QJP73_RS20595 (4255520) | 4255520..4256454 | + | 935 | Protein_4023 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP73_RS20600 (4256871) | 4256871..4257041 | + | 171 | Protein_4024 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T280664 WP_001546109.1 NZ_CP124502:4253058-4253435 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT280664 WP_001546108.1 NZ_CP124502:4252601-4252981 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|