Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4252601..4253435 Replicon chromosome
Accession NZ_CP124502
Organism Escherichia coli strain AVS0970

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QJP73_RS20570 Protein ID WP_001546109.1
Coordinates 4253058..4253435 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7I0L0C8
Locus tag QJP73_RS20565 Protein ID WP_001546108.1
Coordinates 4252601..4252981 (+) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP73_RS20530 (4248881) 4248881..4249336 + 456 WP_001545736.1 IrmA family protein -
QJP73_RS20535 (4249415) 4249415..4249648 + 234 WP_001119729.1 DUF905 family protein -
QJP73_RS20540 (4249748) 4249748..4250566 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP73_RS20545 (4250621) 4250621..4251106 + 486 WP_000849588.1 antirestriction protein -
QJP73_RS20550 (4251122) 4251122..4251598 + 477 WP_001424026.1 RadC family protein -
QJP73_RS20555 (4251667) 4251667..4251888 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP73_RS20560 (4251907) 4251907..4252551 + 645 WP_000086755.1 hypothetical protein -
QJP73_RS20565 (4252601) 4252601..4252981 + 381 WP_001546108.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP73_RS20570 (4253058) 4253058..4253435 + 378 WP_001546109.1 TA system toxin CbtA family protein Toxin
QJP73_RS20575 (4253432) 4253432..4253919 + 488 Protein_4019 DUF5983 family protein -
QJP73_RS20580 (4253936) 4253936..4254133 + 198 WP_000839260.1 DUF957 domain-containing protein -
QJP73_RS20585 (4254218) 4254218..4255063 + 846 WP_001280441.1 DUF4942 domain-containing protein -
QJP73_RS20590 (4255132) 4255132..4255527 + 396 WP_000208383.1 DUF6088 family protein -
QJP73_RS20595 (4255520) 4255520..4256454 + 935 Protein_4023 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP73_RS20600 (4256871) 4256871..4257041 + 171 Protein_4024 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13986.00 Da        Isoelectric Point: 8.5190

>T280664 WP_001546109.1 NZ_CP124502:4253058-4253435 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13997.78 Da        Isoelectric Point: 5.0823

>AT280664 WP_001546108.1 NZ_CP124502:4252601-4252981 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7I0L0C8

References