Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3065937..3066768 | Replicon | chromosome |
| Accession | NZ_CP124502 | ||
| Organism | Escherichia coli strain AVS0970 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QJP73_RS15005 | Protein ID | WP_000854814.1 |
| Coordinates | 3066394..3066768 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A641DSP2 |
| Locus tag | QJP73_RS15000 | Protein ID | WP_001546021.1 |
| Coordinates | 3065937..3066305 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP73_RS14965 (3061154) | 3061154..3062224 | + | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
| QJP73_RS14970 (3062360) | 3062360..3063037 | + | 678 | WP_001362823.1 | hypothetical protein | - |
| QJP73_RS14975 (3063053) | 3063053..3063463 | + | 411 | WP_000846704.1 | hypothetical protein | - |
| QJP73_RS14980 (3063684) | 3063684..3064505 | + | 822 | WP_283192136.1 | DUF932 domain-containing protein | - |
| QJP73_RS14985 (3064597) | 3064597..3065082 | + | 486 | WP_001610806.1 | antirestriction protein | - |
| QJP73_RS14990 (3065097) | 3065097..3065573 | + | 477 | WP_001610807.1 | RadC family protein | - |
| QJP73_RS14995 (3065636) | 3065636..3065857 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QJP73_RS15000 (3065937) | 3065937..3066305 | + | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP73_RS15005 (3066394) | 3066394..3066768 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJP73_RS15010 (3066765) | 3066765..3066959 | + | 195 | WP_000988601.1 | DUF5983 family protein | - |
| QJP73_RS15015 (3067005) | 3067005..3067085 | + | 81 | Protein_2929 | hypothetical protein | - |
| QJP73_RS15020 (3067448) | 3067448..3068194 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP73_RS15025 (3068209) | 3068209..3069750 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP73_RS15030 (3069987) | 3069987..3070343 | + | 357 | WP_000929389.1 | EutP/PduV family microcompartment system protein | - |
| QJP73_RS15035 (3070444) | 3070444..3070773 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T280661 WP_000854814.1 NZ_CP124502:3066394-3066768 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT280661 WP_001546021.1 NZ_CP124502:3065937-3066305 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A641DSP2 |