Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3065937..3066768 Replicon chromosome
Accession NZ_CP124502
Organism Escherichia coli strain AVS0970

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP73_RS15005 Protein ID WP_000854814.1
Coordinates 3066394..3066768 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP73_RS15000 Protein ID WP_001546021.1
Coordinates 3065937..3066305 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP73_RS14965 (3061154) 3061154..3062224 + 1071 WP_000102631.1 patatin-like phospholipase family protein -
QJP73_RS14970 (3062360) 3062360..3063037 + 678 WP_001362823.1 hypothetical protein -
QJP73_RS14975 (3063053) 3063053..3063463 + 411 WP_000846704.1 hypothetical protein -
QJP73_RS14980 (3063684) 3063684..3064505 + 822 WP_283192136.1 DUF932 domain-containing protein -
QJP73_RS14985 (3064597) 3064597..3065082 + 486 WP_001610806.1 antirestriction protein -
QJP73_RS14990 (3065097) 3065097..3065573 + 477 WP_001610807.1 RadC family protein -
QJP73_RS14995 (3065636) 3065636..3065857 + 222 WP_000692323.1 DUF987 domain-containing protein -
QJP73_RS15000 (3065937) 3065937..3066305 + 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP73_RS15005 (3066394) 3066394..3066768 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP73_RS15010 (3066765) 3066765..3066959 + 195 WP_000988601.1 DUF5983 family protein -
QJP73_RS15015 (3067005) 3067005..3067085 + 81 Protein_2929 hypothetical protein -
QJP73_RS15020 (3067448) 3067448..3068194 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP73_RS15025 (3068209) 3068209..3069750 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP73_RS15030 (3069987) 3069987..3070343 + 357 WP_000929389.1 EutP/PduV family microcompartment system protein -
QJP73_RS15035 (3070444) 3070444..3070773 - 330 WP_000450409.1 DUF496 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280661 WP_000854814.1 NZ_CP124502:3066394-3066768 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280661 WP_001546021.1 NZ_CP124502:3065937-3066305 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References