Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1456442..1457060 | Replicon | chromosome |
Accession | NZ_CP124502 | ||
Organism | Escherichia coli strain AVS0970 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QJP73_RS06850 | Protein ID | WP_001291435.1 |
Coordinates | 1456442..1456660 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QJP73_RS06855 | Protein ID | WP_000344800.1 |
Coordinates | 1456686..1457060 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP73_RS06815 (1451730) | 1451730..1452302 | + | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
QJP73_RS06820 (1452333) | 1452333..1452644 | - | 312 | WP_000409908.1 | MGMT family protein | - |
QJP73_RS06830 (1453023) | 1453023..1453376 | + | 354 | WP_000878147.1 | DUF1428 family protein | - |
QJP73_RS06835 (1453418) | 1453418..1454968 | - | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QJP73_RS06840 (1455132) | 1455132..1455602 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QJP73_RS06845 (1455718) | 1455718..1456269 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QJP73_RS06850 (1456442) | 1456442..1456660 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QJP73_RS06855 (1456686) | 1456686..1457060 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QJP73_RS06860 (1457606) | 1457606..1460755 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QJP73_RS06865 (1460778) | 1460778..1461971 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280649 WP_001291435.1 NZ_CP124502:c1456660-1456442 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280649 WP_000344800.1 NZ_CP124502:c1457060-1456686 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |