Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 1043687..1044237 Replicon chromosome
Accession NZ_CP124502
Organism Escherichia coli strain AVS0970

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP73_RS04915 Protein ID WP_001160966.1
Coordinates 1043923..1044237 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP73_RS04910 Protein ID WP_000125566.1
Coordinates 1043687..1043920 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP73_RS04885 (1038760) 1038760..1039047 + 288 WP_000203741.1 ferredoxin-like protein FixX -
QJP73_RS04890 (1039106) 1039106..1040437 + 1332 WP_001183207.1 MFS transporter -
QJP73_RS04895 (1040545) 1040545..1041075 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP73_RS04900 (1041068) 1041068..1042930 + 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP73_RS04905 (1043122) 1043122..1043601 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP73_RS04910 (1043687) 1043687..1043920 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP73_RS04915 (1043923) 1043923..1044237 + 315 WP_001160966.1 CcdB family protein Toxin
QJP73_RS04920 (1044234) 1044234..1045082 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP73_RS04925 (1045089) 1045089..1045466 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP73_RS04930 (1045469) 1045469..1046290 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP73_RS04935 (1046287) 1046287..1047276 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP73_RS04940 (1047276) 1047276..1048562 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T280647 WP_001160966.1 NZ_CP124502:1043923-1044237 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280647 WP_000125566.1 NZ_CP124502:1043687-1043920 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References