Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 862839..863673 | Replicon | chromosome |
Accession | NZ_CP124502 | ||
Organism | Escherichia coli strain AVS0970 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
Locus tag | QJP73_RS04005 | Protein ID | WP_000854770.1 |
Coordinates | 863296..863673 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M1N885 |
Locus tag | QJP73_RS04000 | Protein ID | WP_001280950.1 |
Coordinates | 862839..863207 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP73_RS03970 (857992) | 857992..859892 | + | 1901 | Protein_763 | Ag43/Cah family autotransporter adhesin | - |
QJP73_RS03975 (859963) | 859963..860158 | + | 196 | Protein_764 | DUF905 family protein | - |
QJP73_RS03980 (860276) | 860276..861094 | + | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
QJP73_RS03985 (861436) | 861436..861900 | + | 465 | WP_000855061.1 | antirestriction protein | - |
QJP73_RS03990 (861916) | 861916..862392 | + | 477 | WP_001186779.1 | RadC family protein | - |
QJP73_RS03995 (862455) | 862455..862676 | + | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
QJP73_RS04000 (862839) | 862839..863207 | + | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJP73_RS04005 (863296) | 863296..863673 | + | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
QJP73_RS04010 (863670) | 863670..864158 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
QJP73_RS04015 (864175) | 864175..864351 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
QJP73_RS04020 (864457) | 864457..864606 | + | 150 | Protein_773 | hypothetical protein | - |
QJP73_RS04025 (864973) | 864973..865278 | + | 306 | Protein_774 | helix-turn-helix domain-containing protein | - |
QJP73_RS04030 (865940) | 865940..867562 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 814983..875319 | 60336 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280645 WP_000854770.1 NZ_CP124502:863296-863673 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J6XFW9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M1N885 |