Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 551296..552131 | Replicon | chromosome |
| Accession | NZ_CP124502 | ||
| Organism | Escherichia coli strain AVS0970 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VR61 |
| Locus tag | QJP73_RS02500 | Protein ID | WP_000854747.1 |
| Coordinates | 551296..551673 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
| Locus tag | QJP73_RS02505 | Protein ID | WP_024186867.1 |
| Coordinates | 551763..552131 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP73_RS02475 (547388) | 547388..548926 | - | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| QJP73_RS02480 (549186) | 549186..549345 | - | 160 | Protein_469 | integrase | - |
| QJP73_RS02485 (549663) | 549663..550517 | - | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
| QJP73_RS02490 (550602) | 550602..550799 | - | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QJP73_RS02495 (550811) | 550811..551299 | - | 489 | WP_000761667.1 | DUF5983 family protein | - |
| QJP73_RS02500 (551296) | 551296..551673 | - | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
| QJP73_RS02505 (551763) | 551763..552131 | - | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP73_RS02510 (552210) | 552210..552431 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJP73_RS02515 (552500) | 552500..552976 | - | 477 | WP_001588933.1 | RadC family protein | - |
| QJP73_RS02520 (552991) | 552991..553476 | - | 486 | WP_001588934.1 | antirestriction protein | - |
| QJP73_RS02525 (553567) | 553567..554385 | - | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QJP73_RS02530 (554475) | 554475..554708 | - | 234 | WP_001278280.1 | DUF905 family protein | - |
| QJP73_RS02535 (554714) | 554714..555391 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP73_RS02540 (555539) | 555539..556219 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 523892..565986 | 42094 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T280644 WP_000854747.1 NZ_CP124502:c551673-551296 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT280644 WP_024186867.1 NZ_CP124502:c552131-551763 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A0PK89 |