Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4433120..4433955 | Replicon | chromosome |
| Accession | NZ_CP124500 | ||
| Organism | Escherichia coli strain AVS0744 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A5F0P695 |
| Locus tag | QJB04_RS21650 | Protein ID | WP_022645116.1 |
| Coordinates | 4433578..4433955 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QJB04_RS21645 | Protein ID | WP_078046143.1 |
| Coordinates | 4433120..4433488 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB04_RS21610 (4428784) | 4428784..4429464 | + | 681 | WP_001282921.1 | WYL domain-containing protein | - |
| QJB04_RS21615 (4429612) | 4429612..4430289 | + | 678 | WP_001097302.1 | hypothetical protein | - |
| QJB04_RS21620 (4430295) | 4430295..4430528 | + | 234 | WP_001278293.1 | DUF905 family protein | - |
| QJB04_RS21625 (4430618) | 4430618..4431436 | + | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| QJB04_RS21630 (4431702) | 4431702..4432181 | + | 480 | WP_001564060.1 | antirestriction protein | - |
| QJB04_RS21635 (4432197) | 4432197..4432673 | + | 477 | WP_022645117.1 | RadC family protein | - |
| QJB04_RS21640 (4432736) | 4432736..4432957 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJB04_RS21645 (4433120) | 4433120..4433488 | + | 369 | WP_078046143.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB04_RS21650 (4433578) | 4433578..4433955 | + | 378 | WP_022645116.1 | TA system toxin CbtA family protein | Toxin |
| QJB04_RS21655 (4433952) | 4433952..4434101 | + | 150 | Protein_4249 | DUF5983 family protein | - |
| QJB04_RS21660 (4434180) | 4434180..4434374 | + | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| QJB04_RS21665 (4434459) | 4434459..4435301 | + | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
| QJB04_RS21670 (4435631) | 4435631..4435790 | + | 160 | Protein_4252 | integrase | - |
| QJB04_RS21675 (4436050) | 4436050..4437591 | + | 1542 | WP_115790657.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| QJB04_RS21680 (4437620) | 4437620..4438317 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaCTX-M-15 | - | 4396566..4444642 | 48076 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14021.99 Da Isoelectric Point: 7.8045
>T280642 WP_022645116.1 NZ_CP124500:4433578-4433955 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13602.39 Da Isoelectric Point: 6.7390
>AT280642 WP_078046143.1 NZ_CP124500:4433120-4433488 [Escherichia coli]
VSDTLSGATHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGATHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|