Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4167984..4168818 | Replicon | chromosome |
| Accession | NZ_CP124500 | ||
| Organism | Escherichia coli strain AVS0744 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJB04_RS20290 | Protein ID | WP_000854770.1 |
| Coordinates | 4167984..4168361 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJB04_RS20295 | Protein ID | WP_001280950.1 |
| Coordinates | 4168450..4168818 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB04_RS20265 (4164095) | 4164095..4165717 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJB04_RS20270 (4166379) | 4166379..4166684 | - | 306 | Protein_3977 | helix-turn-helix domain-containing protein | - |
| QJB04_RS20275 (4167051) | 4167051..4167200 | - | 150 | Protein_3978 | hypothetical protein | - |
| QJB04_RS20280 (4167306) | 4167306..4167482 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJB04_RS20285 (4167499) | 4167499..4167987 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJB04_RS20290 (4167984) | 4167984..4168361 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJB04_RS20295 (4168450) | 4168450..4168818 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB04_RS20300 (4168981) | 4168981..4169202 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJB04_RS20305 (4169265) | 4169265..4169741 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJB04_RS20310 (4169757) | 4169757..4170221 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJB04_RS20315 (4170563) | 4170563..4171381 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJB04_RS20320 (4171499) | 4171499..4171694 | - | 196 | Protein_3987 | DUF905 family protein | - |
| QJB04_RS20325 (4171765) | 4171765..4173666 | - | 1902 | Protein_3988 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4156338..4196547 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280641 WP_000854770.1 NZ_CP124500:c4168361-4167984 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT280641 WP_001280950.1 NZ_CP124500:c4168818-4168450 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |