Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3574831..3575449 | Replicon | chromosome |
Accession | NZ_CP124500 | ||
Organism | Escherichia coli strain AVS0744 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QJB04_RS17455 | Protein ID | WP_001291435.1 |
Coordinates | 3575231..3575449 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QJB04_RS17450 | Protein ID | WP_000344800.1 |
Coordinates | 3574831..3575205 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB04_RS17440 (3569920) | 3569920..3571113 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QJB04_RS17445 (3571136) | 3571136..3574285 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QJB04_RS17450 (3574831) | 3574831..3575205 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QJB04_RS17455 (3575231) | 3575231..3575449 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QJB04_RS17460 (3575622) | 3575622..3576173 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QJB04_RS17465 (3576289) | 3576289..3576759 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QJB04_RS17470 (3576923) | 3576923..3578473 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QJB04_RS17475 (3578515) | 3578515..3578868 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
QJB04_RS17485 (3579247) | 3579247..3579558 | + | 312 | WP_000409908.1 | MGMT family protein | - |
QJB04_RS17490 (3579589) | 3579589..3580161 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280637 WP_001291435.1 NZ_CP124500:3575231-3575449 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280637 WP_000344800.1 NZ_CP124500:3574831-3575205 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |