Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1936214..1937045 Replicon chromosome
Accession NZ_CP124500
Organism Escherichia coli strain AVS0744

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJB04_RS09130 Protein ID WP_000854814.1
Coordinates 1936214..1936588 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJB04_RS09135 Protein ID WP_001546021.1
Coordinates 1936677..1937045 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB04_RS09095 (1932209) 1932209..1932538 + 330 WP_000450409.1 DUF496 family protein -
QJB04_RS09100 (1932639) 1932639..1932962 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJB04_RS09105 (1932941) 1932941..1933021 + 81 WP_023441679.1 hypothetical protein -
QJB04_RS09110 (1933232) 1933232..1934773 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJB04_RS09115 (1934788) 1934788..1935534 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJB04_RS09120 (1935897) 1935897..1935977 - 81 Protein_1789 hypothetical protein -
QJB04_RS09125 (1936023) 1936023..1936217 - 195 WP_000988601.1 DUF5983 family protein -
QJB04_RS09130 (1936214) 1936214..1936588 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJB04_RS09135 (1936677) 1936677..1937045 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJB04_RS09140 (1937125) 1937125..1937346 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJB04_RS09145 (1937409) 1937409..1937885 - 477 WP_001186773.1 RadC family protein -
QJB04_RS09150 (1937901) 1937901..1938374 - 474 WP_001385393.1 antirestriction protein -
QJB04_RS09155 (1938637) 1938637..1939458 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJB04_RS09160 (1939679) 1939679..1940089 - 411 WP_000846704.1 hypothetical protein -
QJB04_RS09165 (1940105) 1940105..1940782 - 678 WP_001362823.1 hypothetical protein -
QJB04_RS09170 (1940918) 1940918..1941988 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280630 WP_000854814.1 NZ_CP124500:c1936588-1936214 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280630 WP_001546021.1 NZ_CP124500:c1937045-1936677 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References