Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1009512..1010166 | Replicon | chromosome |
| Accession | NZ_CP124500 | ||
| Organism | Escherichia coli strain AVS0744 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4T2L4 |
| Locus tag | QJB04_RS04960 | Protein ID | WP_000244765.1 |
| Coordinates | 1009759..1010166 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | F4T2L5 |
| Locus tag | QJB04_RS04955 | Protein ID | WP_000354050.1 |
| Coordinates | 1009512..1009778 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB04_RS04935 (1005600) | 1005600..1007033 | - | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
| QJB04_RS04940 (1007078) | 1007078..1007389 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| QJB04_RS04945 (1007553) | 1007553..1008212 | + | 660 | WP_000250275.1 | hemolysin III family protein | - |
| QJB04_RS04950 (1008289) | 1008289..1009269 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
| QJB04_RS04955 (1009512) | 1009512..1009778 | + | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
| QJB04_RS04960 (1009759) | 1009759..1010166 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
| QJB04_RS04965 (1010206) | 1010206..1010727 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QJB04_RS04970 (1010839) | 1010839..1011735 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| QJB04_RS04975 (1011760) | 1011760..1012470 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QJB04_RS04980 (1012476) | 1012476..1014209 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T280628 WP_000244765.1 NZ_CP124500:1009759-1010166 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A7D7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061L3F4 |