Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 890239..891073 | Replicon | chromosome |
| Accession | NZ_CP124500 | ||
| Organism | Escherichia coli strain AVS0744 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QJB04_RS04305 | Protein ID | WP_001546109.1 |
| Coordinates | 890239..890616 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | QJB04_RS04310 | Protein ID | WP_001546108.1 |
| Coordinates | 890693..891073 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB04_RS04275 (886633) | 886633..886803 | - | 171 | Protein_841 | IS110 family transposase | - |
| QJB04_RS04280 (887220) | 887220..888154 | - | 935 | Protein_842 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJB04_RS04285 (888147) | 888147..888542 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| QJB04_RS04290 (888611) | 888611..889456 | - | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| QJB04_RS04295 (889541) | 889541..889738 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| QJB04_RS04300 (889755) | 889755..890242 | - | 488 | Protein_846 | DUF5983 family protein | - |
| QJB04_RS04305 (890239) | 890239..890616 | - | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| QJB04_RS04310 (890693) | 890693..891073 | - | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB04_RS04315 (891123) | 891123..891767 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| QJB04_RS04320 (891786) | 891786..892007 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJB04_RS04325 (892076) | 892076..892552 | - | 477 | WP_001424026.1 | RadC family protein | - |
| QJB04_RS04330 (892568) | 892568..893053 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| QJB04_RS04335 (893108) | 893108..893926 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJB04_RS04340 (894026) | 894026..894259 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJB04_RS04345 (894338) | 894338..894793 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | kpsF / papI | 882426..946381 | 63955 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T280627 WP_001546109.1 NZ_CP124500:c890616-890239 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT280627 WP_001546108.1 NZ_CP124500:c891073-890693 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|