Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 45959..46794 | Replicon | chromosome |
| Accession | NZ_CP124500 | ||
| Organism | Escherichia coli strain AVS0744 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A376WVB1 |
| Locus tag | QJB04_RS00240 | Protein ID | WP_001094448.1 |
| Coordinates | 45959..46336 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3T7EC32 |
| Locus tag | QJB04_RS00245 | Protein ID | WP_024175935.1 |
| Coordinates | 46426..46794 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB04_RS00210 (41327) | 41327..42145 | + | 819 | WP_000779409.1 | lipoprotein NlpA | - |
| QJB04_RS00215 (42149) | 42149..43072 | - | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
| QJB04_RS00220 (43250) | 43250..43747 | - | 498 | WP_000509815.1 | hypothetical protein | - |
| QJB04_RS00225 (44340) | 44340..45185 | - | 846 | WP_000065751.1 | DUF4942 domain-containing protein | - |
| QJB04_RS00230 (45270) | 45270..45462 | - | 193 | Protein_45 | hypothetical protein | - |
| QJB04_RS00235 (45474) | 45474..45962 | - | 489 | WP_000761714.1 | DUF5983 family protein | - |
| QJB04_RS00240 (45959) | 45959..46336 | - | 378 | WP_001094448.1 | TA system toxin CbtA family protein | Toxin |
| QJB04_RS00245 (46426) | 46426..46794 | - | 369 | WP_024175935.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB04_RS00250 (46868) | 46868..47089 | - | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
| QJB04_RS00255 (47158) | 47158..47634 | - | 477 | WP_001186709.1 | RadC family protein | - |
| QJB04_RS00260 (47646) | 47646..48131 | - | 486 | WP_000214415.1 | antirestriction protein | - |
| QJB04_RS00265 (48223) | 48223..49041 | - | 819 | WP_001234753.1 | DUF932 domain-containing protein | - |
| QJB04_RS00270 (49132) | 49132..49365 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 45959..57068 | 11109 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14221.22 Da Isoelectric Point: 8.2919
>T280622 WP_001094448.1 NZ_CP124500:c46336-45959 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A376WVB1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T7EC32 |