Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4477280..4478115 | Replicon | chromosome |
| Accession | NZ_CP124498 | ||
| Organism | Escherichia coli strain AVS0655 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A5F0P695 |
| Locus tag | QJP65_RS21985 | Protein ID | WP_022645116.1 |
| Coordinates | 4477738..4478115 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QJP65_RS21980 | Protein ID | WP_078046143.1 |
| Coordinates | 4477280..4477648 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP65_RS21945 (4472944) | 4472944..4473624 | + | 681 | WP_001282921.1 | WYL domain-containing protein | - |
| QJP65_RS21950 (4473772) | 4473772..4474449 | + | 678 | WP_001097302.1 | hypothetical protein | - |
| QJP65_RS21955 (4474455) | 4474455..4474688 | + | 234 | WP_001278293.1 | DUF905 family protein | - |
| QJP65_RS21960 (4474778) | 4474778..4475596 | + | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| QJP65_RS21965 (4475862) | 4475862..4476341 | + | 480 | WP_001564060.1 | antirestriction protein | - |
| QJP65_RS21970 (4476357) | 4476357..4476833 | + | 477 | WP_022645117.1 | RadC family protein | - |
| QJP65_RS21975 (4476896) | 4476896..4477117 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP65_RS21980 (4477280) | 4477280..4477648 | + | 369 | WP_078046143.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP65_RS21985 (4477738) | 4477738..4478115 | + | 378 | WP_022645116.1 | TA system toxin CbtA family protein | Toxin |
| QJP65_RS21990 (4478112) | 4478112..4478261 | + | 150 | Protein_4317 | DUF5983 family protein | - |
| QJP65_RS21995 (4478340) | 4478340..4478534 | + | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| QJP65_RS22000 (4478619) | 4478619..4479461 | + | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
| QJP65_RS22005 (4479791) | 4479791..4479950 | + | 160 | Protein_4320 | integrase | - |
| QJP65_RS22010 (4480210) | 4480210..4481751 | + | 1542 | WP_115790657.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| QJP65_RS22015 (4481780) | 4481780..4482477 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaCTX-M-15 | - | 4440726..4488802 | 48076 | |
| - | inside | Genomic island | blaCTX-M-15 | - | 4447062..4488802 | 41740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14021.99 Da Isoelectric Point: 7.8045
>T280621 WP_022645116.1 NZ_CP124498:4477738-4478115 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13602.39 Da Isoelectric Point: 6.7390
>AT280621 WP_078046143.1 NZ_CP124498:4477280-4477648 [Escherichia coli]
VSDTLSGATHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGATHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|