Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4212289..4213123 | Replicon | chromosome |
| Accession | NZ_CP124498 | ||
| Organism | Escherichia coli strain AVS0655 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP65_RS20625 | Protein ID | WP_000854770.1 |
| Coordinates | 4212289..4212666 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP65_RS20630 | Protein ID | WP_001280950.1 |
| Coordinates | 4212755..4213123 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP65_RS20600 (4208400) | 4208400..4210022 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJP65_RS20605 (4210684) | 4210684..4210989 | - | 306 | Protein_4045 | helix-turn-helix domain-containing protein | - |
| QJP65_RS20610 (4211356) | 4211356..4211505 | - | 150 | Protein_4046 | hypothetical protein | - |
| QJP65_RS20615 (4211611) | 4211611..4211787 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP65_RS20620 (4211804) | 4211804..4212292 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP65_RS20625 (4212289) | 4212289..4212666 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP65_RS20630 (4212755) | 4212755..4213123 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP65_RS20635 (4213286) | 4213286..4213507 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP65_RS20640 (4213570) | 4213570..4214046 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJP65_RS20645 (4214062) | 4214062..4214526 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJP65_RS20650 (4214868) | 4214868..4215686 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJP65_RS20655 (4215804) | 4215804..4215999 | - | 196 | Protein_4055 | DUF905 family protein | - |
| QJP65_RS20660 (4216070) | 4216070..4217971 | - | 1902 | Protein_4056 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4200643..4240852 | 40209 | |
| - | inside | Genomic island | - | - | 4205465..4240852 | 35387 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280620 WP_000854770.1 NZ_CP124498:c4212666-4212289 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT280620 WP_001280950.1 NZ_CP124498:c4213123-4212755 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |