Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1981746..1982577 Replicon chromosome
Accession NZ_CP124498
Organism Escherichia coli strain AVS0655

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP65_RS09460 Protein ID WP_000854814.1
Coordinates 1981746..1982120 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP65_RS09465 Protein ID WP_001546021.1
Coordinates 1982209..1982577 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP65_RS09425 (1977741) 1977741..1978070 + 330 WP_000450409.1 DUF496 family protein -
QJP65_RS09430 (1978171) 1978171..1978494 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP65_RS09435 (1978473) 1978473..1978553 + 81 WP_023441679.1 hypothetical protein -
QJP65_RS09440 (1978764) 1978764..1980305 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP65_RS09445 (1980320) 1980320..1981066 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP65_RS09450 (1981429) 1981429..1981509 - 81 Protein_1856 hypothetical protein -
QJP65_RS09455 (1981555) 1981555..1981749 - 195 WP_000988601.1 DUF5983 family protein -
QJP65_RS09460 (1981746) 1981746..1982120 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP65_RS09465 (1982209) 1982209..1982577 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP65_RS09470 (1982657) 1982657..1982878 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP65_RS09475 (1982941) 1982941..1983417 - 477 WP_001186773.1 RadC family protein -
QJP65_RS09480 (1983433) 1983433..1983906 - 474 WP_001385393.1 antirestriction protein -
QJP65_RS09485 (1984169) 1984169..1984990 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP65_RS09490 (1985211) 1985211..1985621 - 411 WP_000846704.1 hypothetical protein -
QJP65_RS09495 (1985637) 1985637..1986314 - 678 WP_001362823.1 hypothetical protein -
QJP65_RS09500 (1986450) 1986450..1987520 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1933695..1987520 53825


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280609 WP_000854814.1 NZ_CP124498:c1982120-1981746 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280609 WP_001546021.1 NZ_CP124498:c1982577-1982209 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References