Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 890246..891080 | Replicon | chromosome |
| Accession | NZ_CP124498 | ||
| Organism | Escherichia coli strain AVS0655 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QJP65_RS04310 | Protein ID | WP_001546109.1 |
| Coordinates | 890246..890623 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | QJP65_RS04315 | Protein ID | WP_001546108.1 |
| Coordinates | 890700..891080 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP65_RS04280 (886640) | 886640..886810 | - | 171 | Protein_842 | IS110 family transposase | - |
| QJP65_RS04285 (887227) | 887227..888161 | - | 935 | Protein_843 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP65_RS04290 (888154) | 888154..888549 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| QJP65_RS04295 (888618) | 888618..889463 | - | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| QJP65_RS04300 (889548) | 889548..889745 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| QJP65_RS04305 (889762) | 889762..890249 | - | 488 | Protein_847 | DUF5983 family protein | - |
| QJP65_RS04310 (890246) | 890246..890623 | - | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| QJP65_RS04315 (890700) | 890700..891080 | - | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP65_RS04320 (891130) | 891130..891774 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| QJP65_RS04325 (891793) | 891793..892014 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP65_RS04330 (892083) | 892083..892559 | - | 477 | WP_001424026.1 | RadC family protein | - |
| QJP65_RS04335 (892575) | 892575..893060 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| QJP65_RS04340 (893115) | 893115..893933 | - | 819 | WP_283187749.1 | DUF932 domain-containing protein | - |
| QJP65_RS04345 (894033) | 894033..894266 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJP65_RS04350 (894345) | 894345..894800 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T280606 WP_001546109.1 NZ_CP124498:c890623-890246 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT280606 WP_001546108.1 NZ_CP124498:c891080-890700 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|