Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 358818..359618 | Replicon | chromosome |
Accession | NZ_CP124498 | ||
Organism | Escherichia coli strain AVS0655 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4T503 |
Locus tag | QJP65_RS01670 | Protein ID | WP_000342452.1 |
Coordinates | 359091..359618 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4T504 |
Locus tag | QJP65_RS01665 | Protein ID | WP_001277107.1 |
Coordinates | 358818..359084 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP65_RS01645 (354477) | 354477..355145 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
QJP65_RS01650 (355138) | 355138..356196 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
QJP65_RS01655 (356441) | 356441..357295 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
QJP65_RS01660 (357566) | 357566..358669 | + | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
QJP65_RS01665 (358818) | 358818..359084 | + | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
QJP65_RS01670 (359091) | 359091..359618 | + | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
QJP65_RS01675 (359615) | 359615..359998 | - | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
QJP65_RS01680 (360421) | 360421..361530 | + | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
QJP65_RS01685 (361578) | 361578..362504 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QJP65_RS01690 (362501) | 362501..363778 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
QJP65_RS01695 (363775) | 363775..364542 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T280603 WP_000342452.1 NZ_CP124498:359091-359618 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061K5K9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061YQ57 |