Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 78908..79433 | Replicon | plasmid pAVS0662-A |
Accession | NZ_CP124496 | ||
Organism | Escherichia coli strain AVS0662 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QJP57_RS24480 | Protein ID | WP_001159868.1 |
Coordinates | 78908..79213 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QJP57_RS24485 | Protein ID | WP_000813634.1 |
Coordinates | 79215..79433 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP57_RS24465 (74818) | 74818..75984 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QJP57_RS24470 (76572) | 76572..77327 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QJP57_RS24475 (78101) | 78101..78907 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QJP57_RS24480 (78908) | 78908..79213 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QJP57_RS24485 (79215) | 79215..79433 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QJP57_RS24490 (80012) | 80012..81100 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
QJP57_RS24495 (81102) | 81102..83327 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
QJP57_RS24500 (83377) | 83377..84276 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | senB | 1..88152 | 88152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280599 WP_001159868.1 NZ_CP124496:c79213-78908 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|