Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4004841..4005391 Replicon chromosome
Accession NZ_CP124495
Organism Escherichia coli strain AVS0662

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP57_RS19625 Protein ID WP_001160966.1
Coordinates 4004841..4005155 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP57_RS19630 Protein ID WP_000125566.1
Coordinates 4005158..4005391 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP57_RS19600 (4000516) 4000516..4001802 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP57_RS19605 (4001802) 4001802..4002791 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP57_RS19610 (4002788) 4002788..4003609 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP57_RS19615 (4003612) 4003612..4003989 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP57_RS19620 (4003996) 4003996..4004844 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP57_RS19625 (4004841) 4004841..4005155 - 315 WP_001160966.1 CcdB family protein Toxin
QJP57_RS19630 (4005158) 4005158..4005391 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP57_RS19635 (4005477) 4005477..4005956 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP57_RS19640 (4006148) 4006148..4008010 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP57_RS19645 (4008003) 4008003..4008533 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP57_RS19650 (4008641) 4008641..4009972 - 1332 WP_001183207.1 MFS transporter -
QJP57_RS19655 (4010031) 4010031..4010318 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T280592 WP_001160966.1 NZ_CP124495:c4005155-4004841 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280592 WP_000125566.1 NZ_CP124495:c4005391-4005158 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References