Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2002043..2002874 Replicon chromosome
Accession NZ_CP124495
Organism Escherichia coli strain AVS0662

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP57_RS09545 Protein ID WP_000854814.1
Coordinates 2002043..2002417 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP57_RS09550 Protein ID WP_001546021.1
Coordinates 2002506..2002874 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP57_RS09510 (1998038) 1998038..1998367 + 330 WP_000450409.1 DUF496 family protein -
QJP57_RS09515 (1998468) 1998468..1998791 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP57_RS09520 (1998770) 1998770..1998850 + 81 WP_023441679.1 hypothetical protein -
QJP57_RS09525 (1999061) 1999061..2000602 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP57_RS09530 (2000617) 2000617..2001363 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP57_RS09535 (2001726) 2001726..2001806 - 81 Protein_1874 hypothetical protein -
QJP57_RS09540 (2001852) 2001852..2002046 - 195 WP_000988601.1 DUF5983 family protein -
QJP57_RS09545 (2002043) 2002043..2002417 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP57_RS09550 (2002506) 2002506..2002874 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP57_RS09555 (2002954) 2002954..2003175 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP57_RS09560 (2003238) 2003238..2003714 - 477 WP_001186773.1 RadC family protein -
QJP57_RS09565 (2003730) 2003730..2004203 - 474 WP_001385393.1 antirestriction protein -
QJP57_RS09570 (2004466) 2004466..2005287 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP57_RS09575 (2005508) 2005508..2005918 - 411 WP_000846704.1 hypothetical protein -
QJP57_RS09580 (2005934) 2005934..2006611 - 678 WP_001362823.1 hypothetical protein -
QJP57_RS09585 (2006747) 2006747..2007817 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280582 WP_000854814.1 NZ_CP124495:c2002417-2002043 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280582 WP_001546021.1 NZ_CP124495:c2002874-2002506 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References