Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 818098..818932 | Replicon | chromosome |
| Accession | NZ_CP124495 | ||
| Organism | Escherichia coli strain AVS0662 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QJP57_RS03980 | Protein ID | WP_001546109.1 |
| Coordinates | 818098..818475 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | QJP57_RS03985 | Protein ID | WP_001546108.1 |
| Coordinates | 818552..818932 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP57_RS03950 (814493) | 814493..814663 | - | 171 | Protein_776 | IS110 family transposase | - |
| QJP57_RS03955 (815080) | 815080..816013 | - | 934 | Protein_777 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP57_RS03960 (816006) | 816006..816401 | - | 396 | WP_000208384.1 | DUF6088 family protein | - |
| QJP57_RS03965 (816470) | 816470..817315 | - | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| QJP57_RS03970 (817400) | 817400..817597 | - | 198 | WP_042024643.1 | DUF957 domain-containing protein | - |
| QJP57_RS03975 (817614) | 817614..818101 | - | 488 | Protein_781 | DUF5983 family protein | - |
| QJP57_RS03980 (818098) | 818098..818475 | - | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| QJP57_RS03985 (818552) | 818552..818932 | - | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP57_RS03990 (818982) | 818982..819626 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| QJP57_RS03995 (819645) | 819645..819866 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP57_RS04000 (819935) | 819935..820411 | - | 477 | WP_001424026.1 | RadC family protein | - |
| QJP57_RS04005 (820427) | 820427..820912 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| QJP57_RS04010 (820967) | 820967..821785 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP57_RS04015 (821885) | 821885..822118 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJP57_RS04020 (822197) | 822197..822652 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | kpsS / kpsC / kpsU / kpsD / kpsE / kpsF | 801212..819626 | 18414 | |
| - | flank | IS/Tn | - | - | 814493..814648 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T280579 WP_001546109.1 NZ_CP124495:c818475-818098 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT280579 WP_001546108.1 NZ_CP124495:c818932-818552 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|