Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4146560..4147394 | Replicon | chromosome |
| Accession | NZ_CP124492 | ||
| Organism | Escherichia coli strain AVS0225 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJA99_RS20290 | Protein ID | WP_000854770.1 |
| Coordinates | 4146560..4146937 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJA99_RS20295 | Protein ID | WP_001280950.1 |
| Coordinates | 4147026..4147394 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJA99_RS20265 (4142671) | 4142671..4144293 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJA99_RS20270 (4144955) | 4144955..4145260 | - | 306 | Protein_3975 | helix-turn-helix domain-containing protein | - |
| QJA99_RS20275 (4145627) | 4145627..4145776 | - | 150 | Protein_3976 | hypothetical protein | - |
| QJA99_RS20280 (4145882) | 4145882..4146058 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJA99_RS20285 (4146075) | 4146075..4146563 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJA99_RS20290 (4146560) | 4146560..4146937 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJA99_RS20295 (4147026) | 4147026..4147394 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJA99_RS20300 (4147557) | 4147557..4147778 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJA99_RS20305 (4147841) | 4147841..4148317 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJA99_RS20310 (4148333) | 4148333..4148797 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJA99_RS20315 (4149139) | 4149139..4149957 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJA99_RS20320 (4150075) | 4150075..4150270 | - | 196 | Protein_3985 | DUF905 family protein | - |
| QJA99_RS20325 (4150341) | 4150341..4152242 | - | 1902 | Protein_3986 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4134914..4175123 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280573 WP_000854770.1 NZ_CP124492:c4146937-4146560 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT280573 WP_001280950.1 NZ_CP124492:c4147394-4147026 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |