Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3966229..3966779 Replicon chromosome
Accession NZ_CP124492
Organism Escherichia coli strain AVS0225

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJA99_RS19390 Protein ID WP_001160966.1
Coordinates 3966229..3966543 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJA99_RS19395 Protein ID WP_000125566.1
Coordinates 3966546..3966779 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJA99_RS19365 (3961904) 3961904..3963190 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJA99_RS19370 (3963190) 3963190..3964179 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJA99_RS19375 (3964176) 3964176..3964997 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJA99_RS19380 (3965000) 3965000..3965377 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJA99_RS19385 (3965384) 3965384..3966232 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJA99_RS19390 (3966229) 3966229..3966543 - 315 WP_001160966.1 CcdB family protein Toxin
QJA99_RS19395 (3966546) 3966546..3966779 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJA99_RS19400 (3966865) 3966865..3967344 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJA99_RS19405 (3967536) 3967536..3969398 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJA99_RS19410 (3969391) 3969391..3969921 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJA99_RS19415 (3970029) 3970029..3971360 - 1332 WP_001183207.1 MFS transporter -
QJA99_RS19420 (3971419) 3971419..3971706 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T280571 WP_001160966.1 NZ_CP124492:c3966543-3966229 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280571 WP_000125566.1 NZ_CP124492:c3966779-3966546 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References