Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3553406..3554024 | Replicon | chromosome |
Accession | NZ_CP124492 | ||
Organism | Escherichia coli strain AVS0225 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QJA99_RS17455 | Protein ID | WP_001291435.1 |
Coordinates | 3553806..3554024 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QJA99_RS17450 | Protein ID | WP_000344800.1 |
Coordinates | 3553406..3553780 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJA99_RS17440 (3548495) | 3548495..3549688 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QJA99_RS17445 (3549711) | 3549711..3552860 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QJA99_RS17450 (3553406) | 3553406..3553780 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QJA99_RS17455 (3553806) | 3553806..3554024 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QJA99_RS17460 (3554197) | 3554197..3554748 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QJA99_RS17465 (3554864) | 3554864..3555334 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QJA99_RS17470 (3555498) | 3555498..3557048 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QJA99_RS17475 (3557090) | 3557090..3557443 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
QJA99_RS17485 (3557822) | 3557822..3558133 | + | 312 | WP_000409908.1 | MGMT family protein | - |
QJA99_RS17490 (3558164) | 3558164..3558736 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280569 WP_001291435.1 NZ_CP124492:3553806-3554024 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280569 WP_000344800.1 NZ_CP124492:3553406-3553780 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |