Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3908127..3908677 Replicon chromosome
Accession NZ_CP124490
Organism Escherichia coli strain AVS0456

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP91_RS18925 Protein ID WP_001160966.1
Coordinates 3908127..3908441 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP91_RS18930 Protein ID WP_000125566.1
Coordinates 3908444..3908677 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP91_RS18900 (3903802) 3903802..3905088 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP91_RS18905 (3905088) 3905088..3906077 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP91_RS18910 (3906074) 3906074..3906895 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP91_RS18915 (3906898) 3906898..3907275 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP91_RS18920 (3907282) 3907282..3908130 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP91_RS18925 (3908127) 3908127..3908441 - 315 WP_001160966.1 CcdB family protein Toxin
QJP91_RS18930 (3908444) 3908444..3908677 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP91_RS18935 (3908763) 3908763..3909242 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP91_RS18940 (3909434) 3909434..3911296 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP91_RS18945 (3911289) 3911289..3911819 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP91_RS18950 (3911927) 3911927..3913258 - 1332 WP_001183207.1 MFS transporter -
QJP91_RS18955 (3913317) 3913317..3913604 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T280551 WP_001160966.1 NZ_CP124490:c3908441-3908127 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280551 WP_000125566.1 NZ_CP124490:c3908677-3908444 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References